Structure of PDB 2dpu Chain A Binding Site BS01

Receptor Information
>2dpu Chain A (length=115) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEV
YRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVEL
DRSKKLIEKALSDNF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2dpu Crystal structure of the replication termination protein in complex with a pseudosymmetric 21mer B-site DNA
Resolution3.1 Å
Binding residue
(original residue number in PDB)		K14 Q15 R16 N53 T55 R59
Binding residue
(residue number reindexed from 1)		K7 Q8 R9 N46 T48 R52
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006274 DNA replication termination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2dpu, PDBe:2dpu, PDBj:2dpu
PDBsum2dpu
PubMed
UniProtP0CI76|RTP_BACSU Replication termination protein (Gene Name=rtp)

[Back to BioLiP]