Structure of PDB 2dpd Chain A Binding Site BS01

Receptor Information
>2dpd Chain A (length=115) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEV
YRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVEL
DRSKKLIEKALSDNF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2dpd Crystal structure of the Replication Termination Protein in complex with a pseudosymmetric B-site
Resolution3.17 Å
Binding residue
(original residue number in PDB)		K14 Q15 R16 N53 T55 E56 R59 E84
Binding residue
(residue number reindexed from 1)		K7 Q8 R9 N46 T48 E49 R52 E77
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006274 DNA replication termination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2dpd, PDBe:2dpd, PDBj:2dpd
PDBsum2dpd
PubMed
UniProtP0CI76|RTP_BACSU Replication termination protein (Gene Name=rtp)

[Back to BioLiP]