Structure of PDB 2dgc Chain A Binding Site BS01

Receptor Information

>2dgc Chain A (length=49) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKL

Ligand information

>2dgc Chain B (length=19) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tggagatgacgtcatctcc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2dgc Crystal structure of a bZIP/DNA complex at 2.2 A: determinants of DNA specific recognition.
Resolution	2.2 Å
Binding residue (original residue number in PDB)	R232 N235 T236 R240 R243
Binding residue (residue number reindexed from 1)	R4 N7 T8 R12 R15

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2dgc, PDBe:2dgc, PDBj:2dgc
PDBsum	2dgc
PubMed	7500340
UniProt	P03069\|GCN4_YEAST General control transcription factor GCN4 (Gene Name=GCN4)

[Back to BioLiP]