Structure of PDB 2df6 Chain A Binding Site BS01

Receptor Information
>2df6 Chain A (length=59) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGW
FPSNYVREI
Ligand information
>2df6 Chain C (length=18) Species: 10116 (Rattus norvegicus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PPVIAPRPEHTKSIYTRS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2df6 Crystal Structure of the SH3 Domain of betaPIX in Complex with a High Affinity Peptide from PAK2
Resolution1.3 Å
Binding residue
(original residue number in PDB)		F15 F17 T20 N21 E22 D23 E24 E39 E40 G41 W43 W54 P56 N58 Y59
Binding residue
(residue number reindexed from 1)		F11 F13 T16 N17 E18 D19 E20 E35 E36 G37 W39 W50 P52 N54 Y55
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2df6, PDBe:2df6, PDBj:2df6
PDBsum2df6
PubMed16527308
UniProtO55043|ARHG7_RAT Rho guanine nucleotide exchange factor 7 (Gene Name=Arhgef7)

[Back to BioLiP]