Structure of PDB 2d7h Chain A Binding Site BS01

Receptor Information
>2d7h Chain A (length=102) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AHVALPVPLPRTFDYLLPEGMTVKAGCRVRVPFGKQQERIGIVVSVSDAS
ELPLNELKAVVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPIL
LR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2d7h Structural basis of the 3'-end recognition of a leading strand in stalled replication forks by PriA.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		D17 Y18 K61
Binding residue
(residue number reindexed from 1)		D14 Y15 K58
Enzymatic activity
Enzyme Commision number 3.6.4.-
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:2d7h, PDBe:2d7h, PDBj:2d7h
PDBsum2d7h
PubMed17464287
UniProtP17888|PRIA_ECOLI Primosomal protein N' (Gene Name=priA)

[Back to BioLiP]