Structure of PDB 2d7g Chain A Binding Site BS01

Receptor Information
>2d7g Chain A (length=104) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVAHVALPVPLPRTFDYLLPEGMTVKAGCRVRVPFGKQQERIGIVVSVSD
ASELPLNELKAVVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALP
ILLR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2d7g Structural basis of the 3'-end recognition of a leading strand in stalled replication forks by PriA.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		D17 P35 F36 G37 L55 L60 K61
Binding residue
(residue number reindexed from 1)		D16 P34 F35 G36 L54 L59 K60
Enzymatic activity
Enzyme Commision number 3.6.4.-
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:2d7g, PDBe:2d7g, PDBj:2d7g
PDBsum2d7g
PubMed17464287
UniProtP17888|PRIA_ECOLI Primosomal protein N' (Gene Name=priA)

[Back to BioLiP]