Structure of PDB 2d30 Chain A Binding Site BS01

Receptor Information

>2d30 Chain A (length=124) Species: 1392 (Bacillus anthracis)

MNSKQLIQEAIEARKQAYVPYSKFQVGAALLTQDGKVYRGCNVENASYGL
CNCAERTALFKAVSEGDKEFVAIAIVADTKRPVPPCGACRQVMVELCKQD
TKVYLSNLHGDVQETTVGELLPGA

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 2d30 Chain A Residue 2001

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2d30 Crystal Structure of Cytidine Deaminase Cdd-2 (BA4525) from Bacillus Anthracis at 2.40A Resolution
• Resolution: 2.4 Å
• Binding residue (original residue number in PDB): C53 C89
• Binding residue (residue number reindexed from 1): C53 C89
• Annotation score: 1

Enzymatic activity

• Enzyme Commision number: 3.5.4.5: cytidine deaminase.

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004126 cytidine deaminase activity
• GO:0008270 zinc ion binding
• GO:0016787 hydrolase activity
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009972 cytidine deamination
• GO:0055086 nucleobase-containing small molecule metabolic process
• GO:0072527 pyrimidine-containing compound metabolic process
• GO:1901135 carbohydrate derivative metabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:2d30, PDBe:2d30, PDBj:2d30
• PDBsum: 2d30
• UniProt: A0A6L7GZQ8