Structure of PDB 2d0n Chain A Binding Site BS01

Receptor Information
>2d0n Chain A (length=59) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSPWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFP
ANYVAPMMR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2d0n Crystal structure of the C-terminal SH3 domain of the adaptor protein GADS in complex with SLP-76 motif peptide reveals a unique SH3-SH3 interaction
Resolution1.57 Å
Binding residue
(original residue number in PDB)		Y272 F274 E278 D280 E281 W300 L311 Y316
Binding residue
(residue number reindexed from 1)		Y9 F11 E15 D17 E18 W37 L48 Y53
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2d0n, PDBe:2d0n, PDBj:2d0n
PDBsum2d0n
PubMed17010654
UniProtO89100|GRAP2_MOUSE GRB2-related adaptor protein 2 (Gene Name=Grap2)

[Back to BioLiP]