Structure of PDB 2czy Chain A Binding Site BS01

Receptor Information
>2czy Chain A (length=77) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVHVEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVS
QLFHEHPDLIVGFNAFLPLGYRIDIPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2czy The Neural Repressor NRSF/REST Binds the PAH1 Domain of the Sin3 Corepressor by Using its Distinct Short Hydrophobic Helix
ResolutionN/A
Binding residue
(original residue number in PDB)		V32 L59 M62 K63 F65 K66 F96
Binding residue
(residue number reindexed from 1)		V2 L29 M32 K33 F35 K36 F66
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003714 transcription corepressor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2czy, PDBe:2czy, PDBj:2czy
PDBsum2czy
PubMed16288918
UniProtQ62141|SIN3B_MOUSE Paired amphipathic helix protein Sin3b (Gene Name=Sin3b)

[Back to BioLiP]