Structure of PDB 2czj Chain A Binding Site BS01

Receptor Information
>2czj Chain A (length=122) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APVLENRRARHDYEILETYEAGIALKGTEVKSLRAGKVDFTGSFARFEDG
ELYLENLYIAPYEKGSYANVDPRRKRKLLLHKHELRRLLGKVEQKGLTLV
PLKIYFNERGYAKVLLGLARGK
Ligand information
>2czj Chain B (length=62) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggggugaaacggucucgacagggguucgccuuuggacguggguucgacu
cccaccaccucc
<<<<<<<............<<<<<<....>>>>>>...<<<<<.......
>>>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2czj Structural basis for functional mimicry of long-variable-arm tRNA by transfer-messenger RNA.
Resolution3.01 Å
Binding residue
(original residue number in PDB)		E21 G23 I24 L26 K27 G28 T29 V31 K32 R35 E52 Y63 S67 K78 L80 L81 H82 R110 Y112 A113 K114
Binding residue
(residue number reindexed from 1)		E20 G22 I23 L25 K26 G27 T28 V30 K31 R34 E51 Y62 S66 K77 L79 L80 H81 R109 Y111 A112 K113
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:2czj, PDBe:2czj, PDBj:2czj
PDBsum2czj
PubMed17488812
UniProtQ8RR57|SSRP_THET8 SsrA-binding protein (Gene Name=smpB)

[Back to BioLiP]