Structure of PDB 2ct9 Chain A Binding Site BS01

Receptor Information
>2ct9 Chain A (length=185) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPEL
AINPLGDRIINAFFSEGEDQVNFRGFMRTLAHFRPIEEPLNSRSNKLHFA
FRLYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGD
SAISFTEFVKVLEKVDVEQKMSIRFLHKLAAALEH
Ligand information
Ligand IDCA
InChIInChI=1S/Ca/q+2
InChIKeyBHPQYMZQTOCNFJ-UHFFFAOYSA-N
SMILES
SoftwareSMILES
CACTVS 3.341[Ca++]
ACDLabs 10.04
OpenEye OEToolkits 1.5.0		[Ca+2]
FormulaCa
NameCALCIUM ION
ChEMBL
DrugBankDB14577
ZINC
PDB chain2ct9 Chain A Residue 301 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ct9 Structural characterization of calcineurin B homologous protein 1
Resolution2.2 Å
Binding residue
(original residue number in PDB)		D123 D125 D127 K129 E134
Binding residue
(residue number reindexed from 1)		D105 D107 D109 K111 E116
Annotation score1
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004860 protein kinase inhibitor activity
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0008017 microtubule binding
GO:0015385 sodium:proton antiporter activity
GO:0019900 kinase binding
GO:0046872 metal ion binding
GO:0048306 calcium-dependent protein binding
Biological Process
GO:0001578 microtubule bundle formation
GO:0001933 negative regulation of protein phosphorylation
GO:0006469 negative regulation of protein kinase activity
GO:0006611 protein export from nucleus
GO:0006903 vesicle targeting
GO:0006906 vesicle fusion
GO:0010923 negative regulation of phosphatase activity
GO:0015031 protein transport
GO:0022406 membrane docking
GO:0031122 cytoplasmic microtubule organization
GO:0031397 negative regulation of protein ubiquitination
GO:0031953 negative regulation of protein autophosphorylation
GO:0032088 negative regulation of NF-kappaB transcription factor activity
GO:0032417 positive regulation of sodium:proton antiporter activity
GO:0035725 sodium ion transmembrane transport
GO:0042308 negative regulation of protein import into nucleus
GO:0050821 protein stabilization
GO:0051222 positive regulation of protein transport
GO:0051259 protein complex oligomerization
GO:0051453 regulation of intracellular pH
GO:0060050 positive regulation of protein glycosylation
GO:0061024 membrane organization
GO:0061025 membrane fusion
GO:0070885 negative regulation of calcineurin-NFAT signaling cascade
GO:0071073 positive regulation of phospholipid biosynthetic process
GO:0071468 cellular response to acidic pH
GO:0090314 positive regulation of protein targeting to membrane
Cellular Component
GO:0000139 Golgi membrane
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005793 endoplasmic reticulum-Golgi intermediate compartment
GO:0005856 cytoskeleton
GO:0005886 plasma membrane
GO:0012505 endomembrane system
GO:0015630 microtubule cytoskeleton
GO:0030133 transport vesicle
GO:0045121 membrane raft
GO:1990351 transporter complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2ct9, PDBe:2ct9, PDBj:2ct9
PDBsum2ct9
PubMed15987692
UniProtP61023|CHP1_RAT Calcineurin B homologous protein 1 (Gene Name=Chp1)

[Back to BioLiP]