Structure of PDB 2cnm Chain A Binding Site BS01

Receptor Information
>2cnm Chain A (length=151) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNTISILSTTDLPAAWQIEQRAHAFPWSEKTFFGNQGERYLNLKLTADDR
MAAFAITQVVLDEATLFNIAVDPDFQRRGLGRMLLEHLIDELETRGVVTL
WLEVRASNAAAIALYESLGFNEATIRRNYYPTAQGHEDAIIMALPISMKL
H
Ligand information
>2cnm Chain D (length=6) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ARYFRR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2cnm Crystal Structure of Rimi from Salmonella Typhimurium Lt2, the Gnat Responsible for N{Alpha}- Acetylation of Ribosomal Protein S18.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
W27 S28 T31 F67 N68 E103 Y129 Y130 P131
Binding residue
(residue number reindexed from 1)
W27 S28 T31 F67 N68 E103 Y129 Y130 P131
Enzymatic activity
Enzyme Commision number 2.3.1.266: [ribosomal protein bS18]-alanine N-acetyltransferase.
Gene Ontology
Molecular Function
GO:0008080 N-acetyltransferase activity
GO:0008999 peptide-alanine-alpha-N-acetyltransferase activity
GO:0016746 acyltransferase activity
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups
Biological Process
GO:0006474 N-terminal protein amino acid acetylation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2cnm, PDBe:2cnm, PDBj:2cnm
PDBsum2cnm
PubMed18596200
UniProtQ8ZJW4|RIMI_SALTY [Ribosomal protein bS18]-alanine N-acetyltransferase (Gene Name=rimI)

[Back to BioLiP]