Structure of PDB 2ckb Chain A Binding Site BS01

Receptor Information

>2ckb Chain A (length=202) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGLQLLLKYY
SGDPVVQGVNGFEAEFSKSNSSFHLRKASVHWSDSAVYFCAVSGFASALT
FGSGTKVIVLPYIQNPEPAVYALKDPRSQDSTLCLFTDFDSQINVPKTME
SGTFITDATVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDV
PC

Ligand information

>2ckb Chain P (length=8) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

EQYKFYSV

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2ckb Structural basis of plasticity in T cell receptor recognition of a self peptide-MHC antigen.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	S93 G99 A101
Binding residue (residue number reindexed from 1)	S93 G94 A96

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0002250	adaptive immune response

	Cellular Component
GO:0042101	T cell receptor complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2ckb, PDBe:2ckb, PDBj:2ckb
PDBsum	2ckb
PubMed	9469799
UniProt	P01738\|TVA1_MOUSE T-cell receptor alpha chain V region PHDS58

[Back to BioLiP]