Structure of PDB 2cjk Chain A Binding Site BS01

Receptor Information
>2cjk Chain A (length=167) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFL
SFEKPSSVDEVVKTQHILDGKVIDPKRAIPRDEQDKTGKIFVGGIGPDVR
PKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVCQNKF
IDFKDRKIEIKRAEPRH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2cjk Grabbing the message: structural basis of mRNA 3'UTR recognition by Hrp1.
ResolutionN/A
Binding residue
(original residue number in PDB)		F162 I163 G164 L166 N167 W168 K189 M191 R200 G201 F202 F204 D229 K231 R232 A233 I234 R236 Q239 F246 M275 D277 F286 F288 E314 R321
Binding residue
(residue number reindexed from 1)		F7 I8 G9 L11 N12 W13 K34 M36 R45 G46 F47 F49 D74 K76 R77 A78 I79 R81 Q84 F91 M120 D122 F131 F133 E159 R166
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:2cjk, PDBe:2cjk, PDBj:2cjk
PDBsum2cjk
PubMed16794580
UniProtQ99383|HRP1_YEAST Nuclear polyadenylated RNA-binding protein 4 (Gene Name=HRP1)

[Back to BioLiP]