Structure of PDB 2cia Chain A Binding Site BS01

Receptor Information
>2cia Chain A (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEWYYGNVTRHQAECALNERGVEGDFLIRDSESSPSDFSVSLKASGKNKH
FKVQLVDNVYCIGQRRFHTMDELVEHYKKAPIFTSEHGEKLYLVRALQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2cia The Phosphotyrosine Peptide Binding Specificity of Nck1 and Nck2 Src Homology 2 Domains.
Resolution1.45 Å
Binding residue
(original residue number in PDB)		R292 R311 S313 E314 S315 S321 K331 H332 F333 K334 I344 G345 I364 F365
Binding residue
(residue number reindexed from 1)		R10 R29 S31 E32 S33 S39 K49 H50 F51 K52 I62 G63 I82 F83
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2cia, PDBe:2cia, PDBj:2cia
PDBsum2cia
PubMed16636066
UniProtO43639|NCK2_HUMAN Cytoplasmic protein NCK2 (Gene Name=NCK2)

[Back to BioLiP]