Structure of PDB 2ci9 Chain A Binding Site BS01

Receptor Information
>2ci9 Chain A (length=102) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSPWYYGKVTRHQAEMALNERGHEGDFLIRDSESSPNDFSVSLKAQG
KNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAPIFTSEQGEKLYLVKH
LS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ci9 The Phosphotyrosine Peptide Binding Specificity of Nck1 and Nck2 Src Homology 2 Domains.
Resolution1.5 Å
Binding residue
(original residue number in PDB)
R289 R308 S310 E311 S312 S318 K328 H329 F330 R344 I361
Binding residue
(residue number reindexed from 1)
R14 R33 S35 E36 S37 S43 K53 H54 F55 R69 I86
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2ci9, PDBe:2ci9, PDBj:2ci9
PDBsum2ci9
PubMed16636066
UniProtP16333|NCK1_HUMAN SH2/SH3 adapter protein NCK1 (Gene Name=NCK1)

[Back to BioLiP]