Structure of PDB 2c7a Chain A Binding Site BS01

Receptor Information

>2c7a Chain A (length=78) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHNYLCAGRNDCIVD
KIRRKNCPACRLRKCCQAGMVLGGRKFK

Ligand information

>2c7a Chain C (length=18) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ccagaacagtttgttctg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2c7a Structure of the Progesterone Receptor-Deoxyribonucleic Acid Complex: Novel Interactions Required for Binding to Half-Site Response Elements.
Resolution	2.5 Å
Binding residue (original residue number in PDB)	C577 H578 Y579 K588 K592 K617 G635 R637 K638
Binding residue (residue number reindexed from 1)	C15 H16 Y17 K26 K30 K55 G73 R75 K76
Binding affinity	PDBbind-CN: Kd=133nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0008270	zinc ion binding
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2c7a, PDBe:2c7a, PDBj:2c7a
PDBsum	2c7a
PubMed	16931575
UniProt	P06401\|PRGR_HUMAN Progesterone receptor (Gene Name=PGR)

[Back to BioLiP]