Structure of PDB 2c51 Chain A Binding Site BS01

Receptor Information
>2c51 Chain A (length=129) Species: 12022 (Escherichia phage MS2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQ
SSAQNRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNMELTIPIFATNSD
CELIVKAMQGLLKDGNPIPSAIAANSGIY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2c51 Structural basis of pyrimidine specificity in the MS2 RNA hairpin-coat-protein complex.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		T45 S47 T59 E63 Y85 N87
Binding residue
(residue number reindexed from 1)		T45 S47 T59 E63 Y85 N87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005198 structural molecule activity
GO:0042802 identical protein binding
Biological Process
GO:0006417 regulation of translation
GO:1904972 negative regulation of viral translation
Cellular Component
GO:0019028 viral capsid
GO:0039617 T=3 icosahedral viral capsid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2c51, PDBe:2c51, PDBj:2c51
PDBsum2c51
PubMed11720290
UniProtP03612|CAPSD_BPMS2 Capsid protein

[Back to BioLiP]