Structure of PDB 2c23 Chain A Binding Site BS01

Receptor Information
>2c23 Chain A (length=225) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKN
VVGARRSSWRVISSIEQKKKQQMGKEYREKIEAELQDICNDVLELLDKYL
IPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEI
SKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDT
LNEESYKDSTLIMQLLRDNLTLWTS
Ligand information
>2c23 Chain P (length=11) Species: 287 (Pseudomonas aeruginosa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GLLDALDLASK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2c23 Structural Basis for Protein-Protein Interactions in the 14-3-3 Protein Family.
Resolution2.65 Å
Binding residue
(original residue number in PDB)		N44 S47 V48 K51 F119 Y130 N175 V178 D215 L222
Binding residue
(residue number reindexed from 1)		N42 S45 V46 K49 F112 Y123 N168 V171 D208 L215
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004860 protein kinase inhibitor activity
GO:0005515 protein binding
GO:0019899 enzyme binding
GO:0019904 protein domain specific binding
GO:0042802 identical protein binding
GO:0042826 histone deacetylase binding
GO:0045296 cadherin binding
GO:0050815 phosphoserine residue binding
GO:0051219 phosphoprotein binding
Biological Process
GO:0006605 protein targeting
GO:0007165 signal transduction
GO:0008104 protein localization
GO:0043085 positive regulation of catalytic activity
GO:0045744 negative regulation of G protein-coupled receptor signaling pathway
GO:0051220 cytoplasmic sequestering of protein
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005773 vacuole
GO:0005774 vacuolar membrane
GO:0005829 cytosol
GO:0005925 focal adhesion
GO:0016020 membrane
GO:0042470 melanosome
GO:0048471 perinuclear region of cytoplasm
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2c23, PDBe:2c23, PDBj:2c23
PDBsum2c23
PubMed17085597
UniProtP31946|1433B_HUMAN 14-3-3 protein beta/alpha (Gene Name=YWHAB)

[Back to BioLiP]