Structure of PDB 2c06 Chain A Binding Site BS01

Receptor Information

>2c06 Chain A (length=110) Species: 562 (Escherichia coli)

MERGEIWLVSLDPTAGHEQQGTRPVLIVTPAAFNRVTRLPVVVPVTSGGN
FARTAGFAVSLDGVGIRTTGVVRCDQPRTIDMKARGGKRLERVPETIMNE
VLGRLSTILT

Ligand information

>2c06 Chain C (length=5)

auaca

.....

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2c06 Model for RNA Binding and the Catalytic Site of the Rnase Kid of the Bacterial Pard Toxin-Antitoxin System.
• Resolution: N/A
• Binding residue (original residue number in PDB): D12 H17 Q19 Q20 G21 T22 R23 T46 S47 A55 G56 F57 R73 D75 Q76
• Binding residue (residue number reindexed from 1): D12 H17 Q19 Q20 G21 T22 R23 T46 S47 A55 G56 F57 R73 D75 Q76

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Gene Ontology

Molecular Function

• GO:0003677 DNA binding

External links

• PDB: RCSB:2c06, PDBe:2c06, PDBj:2c06
• PDBsum: 2c06
• PubMed: 16413033
• UniProt: P13976|PEMK_ECOLX Endoribonuclease PemK (Gene Name=pemK)