Structure of PDB 2bzf Chain A Binding Site BS01

Receptor Information
>2bzf Chain A (length=88) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLV
LKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2bzf Structural Basis for DNA Bridging by Barrier-to-Autointegration Factor.
Resolution2.87 Å
Binding residue
(original residue number in PDB)		N70 A71
Binding residue
(residue number reindexed from 1)		N69 A70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0005515 protein binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006979 response to oxidative stress
GO:0007084 mitotic nuclear membrane reassembly
GO:0009615 response to virus
GO:0010836 negative regulation of protein ADP-ribosylation
GO:0015074 DNA integration
GO:0032480 negative regulation of type I interferon production
GO:0045071 negative regulation of viral genome replication
GO:0045824 negative regulation of innate immune response
GO:0051276 chromosome organization
GO:0160049 negative regulation of cGAS/STING signaling pathway
Cellular Component
GO:0000785 chromatin
GO:0000793 condensed chromosome
GO:0005634 nucleus
GO:0005635 nuclear envelope
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2bzf, PDBe:2bzf, PDBj:2bzf
PDBsum2bzf
PubMed16155580
UniProtO75531|BAF_HUMAN Barrier-to-autointegration factor (Gene Name=BANF1)

[Back to BioLiP]