Structure of PDB 2buo Chain A Binding Site BS01

Receptor Information
>2buo Chain A (length=84) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANP
DCKTILKALGPGATLEEMMTACQGVGGPGHKARV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2buo The HIV-1 Capsid Protein C-Terminal Domain in Complex with a Virus Assembly Inhibitor
Resolution1.7 Å
Binding residue
(original residue number in PDB)		V165 D166 Y169 L172 Q179 K182 N183 T186 E187 L211 E212 V230
Binding residue
(residue number reindexed from 1)		V19 D20 Y23 L26 Q33 K36 N37 T40 E41 L65 E66 V84
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2buo, PDBe:2buo, PDBj:2buo
PDBsum2buo
PubMed16041386
UniProtP03347|GAG_HV1B1 Gag polyprotein (Gene Name=gag)

[Back to BioLiP]