Structure of PDB 2brq Chain A Binding Site BS01

Receptor Information
>2brq Chain A (length=94) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISF
EDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2brq The Molecular Basis of Filamin Binding to Integrins and Competition with Talin.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		G2267 A2268 G2269 G2270 L2271 A2272 I2273 A2274 V2275 E2276 G2277 P2278 S2279 K2280 A2281 I2283 F2285
Binding residue
(residue number reindexed from 1)		G32 A33 G34 G35 L36 A37 I38 A39 V40 E41 G42 P43 S44 K45 A46 I48 F50
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0051015 actin filament binding
Biological Process
GO:0030036 actin cytoskeleton organization

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2brq, PDBe:2brq, PDBj:2brq
PDBsum2brq
PubMed16455489
UniProtP21333|FLNA_HUMAN Filamin-A (Gene Name=FLNA)

[Back to BioLiP]