Structure of PDB 2bqz Chain A Binding Site BS01

Receptor Information
>2bqz Chain A (length=161) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDF
VVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETN
RLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSK
ASIEAHPWLKH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2bqz Specificity and Mechanism of the Histone Methyltransferase Pr-Set7
Resolution1.5 Å
Binding residue
(original residue number in PDB)
Y245 E259 A263 D265 P266 T268 C270 M272 Y273 Y274 T307 K308 Y336 G337 D338 S343 H347 W349
Binding residue
(residue number reindexed from 1)
Y54 E68 A72 D74 P75 T77 C79 M81 Y82 Y83 T116 K117 Y145 G146 D147 S152 H156 W158
Enzymatic activity
Enzyme Commision number 2.1.1.-
2.1.1.361: [histone H4]-lysine(20) N-methyltransferase.
Gene Ontology
Molecular Function
GO:0042799 histone H4K20 methyltransferase activity

View graph for
Molecular Function
External links
PDB RCSB:2bqz, PDBe:2bqz, PDBj:2bqz
PDBsum2bqz
PubMed15933069
UniProtQ9NQR1|KMT5A_HUMAN N-lysine methyltransferase KMT5A (Gene Name=KMT5A)

[Back to BioLiP]