Structure of PDB 2bop Chain A Binding Site BS01

Receptor Information
>2bop Chain A (length=85) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SCFALISGTANQVKCYRFRVKKNHRHRYENCTTTWFTVADNGAERQGQAQ
ILITFGSPSQRQDFLKHVPLPPGMNISGFTASLDF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2bop Crystal structure at 1.7 A of the bovine papillomavirus-1 E2 DNA-binding domain bound to its DNA target.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		K339 R342 F343 T359 F361
Binding residue
(residue number reindexed from 1)		K14 R17 F18 T34 F36
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006275 regulation of DNA replication
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0042025 host cell nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2bop, PDBe:2bop, PDBj:2bop
PDBsum2bop
PubMed1328886
UniProtP03122|VE2_BPV1 Regulatory protein E2 (Gene Name=E2)

[Back to BioLiP]