Structure of PDB 2bn5 Chain A Binding Site BS01

Receptor Information
>2bn5 Chain A (length=33) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GADYSAQWAEYYRSVGKIEEAEAIEKTLKNKQN
Ligand information
>2bn5 Chain B (length=21) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RPPPAHHNMFSVPPPPILGRG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2bn5 Structural Basis of the Interaction between P-Element Somatic Inhibitor and U1-70K Essential for the Alternative Splicing of P-Element Transposase.
ResolutionN/A
Binding residue
(original residue number in PDB)		E660 Y661 Y662 V665 I674
Binding residue
(residue number reindexed from 1)		E10 Y11 Y12 V15 I24
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2bn5, PDBe:2bn5, PDBj:2bn5
PDBsum2bn5
PubMed15990112
UniProtQ7JPS0

[Back to BioLiP]