Structure of PDB 2bh2 Chain A Binding Site BS01

Receptor Information
>2bh2 Chain A (length=418) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIITVSVNDLDSFGQGVARHNGKTLFIPGLLPQENAEVTVTEDKKQYARA
KVVRRLSDSPERETPRCPHFGVCGGCQQQHASVDLQQRSKSAALARLMKH
DVSEVIADVPWGYRRRARLSLNYLPKTQQLQMGFRKAGSSDIVDVKQCPI
LAPQLEALLPKVRACLGSLQAMRHLGHVELVQATSGTLMILRHTAPLSSA
DREKLERFSHSEGLDLYLAPDSEILETVSGEMPWYDSNGLRLTFSPRDFI
QVNAGVNQKMVARALEWLDVQPEDRVLDLFCGMGNFTLPLATQAASVVGV
EGVPALVEKGQQNARLNGLQNVTFYHENLEEDVTKQPWAKNGFDKVLLDP
ARAGAAGVMQQIIKLEPIRIVYVSCNPATLARDSEALLKAGYTIARLAML
DMFPHTGHLESMVLFSRV
Ligand information
>2bh2 Chain C (length=30) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcgaaauuccuugucggguaaguuccgac
.............<<<<<<.....>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2bh2 A Unique RNA Fold in the Ruma-RNA-Cofactor Ternary Complex Contributes to Substrate Selectivity and Enzymatic Function
Resolution2.15 Å
Binding residue
(original residue number in PDB)		D23 D25 F27 Q29 R33 N35 G36 K37 T38 F40 K58 K59 Q60 Y61 G88 G89 R110 R128 R130 A131 R132 L135 N136 F148 R149 G152 G190 H191 R206 F263 Q265 N342 D363 P364 A365 R366 C389 A392 R396 F417 H422 E424
Binding residue
(residue number reindexed from 1)		D9 D11 F13 Q15 R19 N21 G22 K23 T24 F26 K44 K45 Q46 Y47 G74 G75 R96 R114 R116 A117 R118 L121 N122 F134 R135 G138 G176 H177 R192 F249 Q251 N328 D349 P350 A351 R352 C375 A378 R382 F403 H408 E410
Enzymatic activity
Enzyme Commision number 2.1.1.190: 23S rRNA (uracil(1939)-C(5))-methyltransferase.
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005506 iron ion binding
GO:0008168 methyltransferase activity
GO:0008173 RNA methyltransferase activity
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity
GO:0046872 metal ion binding
GO:0051539 4 iron, 4 sulfur cluster binding
GO:0070041 rRNA (uridine-C5-)-methyltransferase activity
Biological Process
GO:0006364 rRNA processing
GO:0006396 RNA processing
GO:0009451 RNA modification
GO:0031167 rRNA methylation
GO:0032259 methylation
GO:0070475 rRNA base methylation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2bh2, PDBe:2bh2, PDBj:2bh2
PDBsum2bh2
PubMed15766524
UniProtP55135|RLMD_ECOLI 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (Gene Name=rlmD)

[Back to BioLiP]