Structure of PDB 2bgw Chain A Binding Site BS01

Receptor Information

>2bgw Chain A (length=219) Species: 56636 (Aeropyrum pernix) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MLEDPGGRPRVYVDVREERSPVPSILESLGVQVIPKQLPMGDYLVSDSII
VERKTSSDFAKSLFDGRLFEQASRLAEHYETVFIIVEGPPVPRRYRGRER
SLYAAMAALQLDYGIRLMNTMDPKGTALVIESLARLSTREGGQRIVIHKK
PRLSDVREWQLYILQSFPGIGRRTAERILERFGSLERFFTASKAEISKVE
GIGEKRAEEIKKILMTPYK

Ligand information

>2bgw Chain C (length=15) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gatcacagatgctga

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2bgw Structure of an XPF endonuclease with and without DNA suggests a model for substrate recognition.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	A86 Y123 G179 I180 G181 R182 R183 T184 R187
Binding residue (residue number reindexed from 1)	A76 Y113 G169 I170 G171 R172 R173 T174 R177

Enzymatic activity

Enzyme Commision number

2.7.7.-

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004518	nuclease activity

	Biological Process
GO:0006281	DNA repair

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2bgw, PDBe:2bgw, PDBj:2bgw
PDBsum	2bgw
PubMed	15719018
UniProt	Q9YC15

[Back to BioLiP]