Structure of PDB 2bec Chain A Binding Site BS01

Receptor Information
>2bec Chain A (length=181) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IPDGDSIRRETGFSQASLLRLHHRFRALDRNKKGYLSRMDLQQIGALAVN
PLGDRIIESFFPDGSQRVDFPGFVRVLAHFRPVEDEDTEKPEPLNSRRNK
LHYAFQLYDLDRDGKISRHEMLQVLRLMVGVQVTEEQLENIADRTVQEAD
EDGDGAVSFVEFTKSLEKMDVEQKMSIRILK
Ligand information
>2bec Chain B (length=25) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RSINEEIHTQFLDHLLTGIEDICGH
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2bec Crystal structure of CHP2 complexed with NHE1-cytosolic region and an implication for pH regulation
Resolution2.7 Å
Binding residue
(original residue number in PDB)		R30 R34 A56 L57 N60 P61 L62 I66 F83 L87 F90 Y118 L122 Y123 M143 R159 T160 E163 A164 F177 L181 K183 M184 K189 M190 S191 I192 R193 I194
Binding residue
(residue number reindexed from 1)		R20 R24 A46 L47 N50 P51 L52 I56 F73 L77 F80 Y103 L107 Y108 M128 R144 T145 E148 A149 F162 L166 K168 M169 K174 M175 S176 I177 R178 I179
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0046872 metal ion binding
Biological Process
GO:0008284 positive regulation of cell population proliferation
GO:0010922 positive regulation of phosphatase activity
GO:0015031 protein transport
GO:0042307 positive regulation of protein import into nucleus
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0070886 positive regulation of calcineurin-NFAT signaling cascade
GO:0071277 cellular response to calcium ion
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2bec, PDBe:2bec, PDBj:2bec
PDBsum2bec
PubMed16710297
UniProtO43745|CHP2_HUMAN Calcineurin B homologous protein 2 (Gene Name=CHP2)

[Back to BioLiP]