Structure of PDB 2bbu Chain A Binding Site BS01

Receptor Information

>2bbu Chain A (length=156) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHF
FTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMP
PPGTPSFSLPPTEPSSEVPEQPPAQALPGSTPKRAYYIYSGGEKIPLVLS
RPLSSN

Ligand information

>2bbu Chain B (length=15) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

STASTVEYSTVVHSG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2bbu The Structure of SOCS3 Reveals the Basis of the Extended SH2 Domain Function and Identifies an Unstructured Insertion That Regulates Stability
Resolution	N/A
Binding residue (original residue number in PDB)	G24 K62 N63 L64 R65 Q76 H97 A135 Y136 Y137 Y139
Binding residue (residue number reindexed from 1)	G24 K62 N63 L64 R65 Q76 H97 A135 Y136 Y137 Y139

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:2bbu, PDBe:2bbu, PDBj:2bbu
PDBsum	2bbu
PubMed	16630890
UniProt	O35718\|SOCS3_MOUSE Suppressor of cytokine signaling 3 (Gene Name=Socs3)

[Back to BioLiP]