Structure of PDB 2b6g Chain A Binding Site BS01

Receptor Information
>2b6g Chain A (length=81) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NPKSLTDPKLLKNIPMWLKSLRLHKYSDALSGTPWIELIYLDDETLEKKG
VLALGARRKLLKAFGIVIDYKERDLIDRSAY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2b6g RNA recognition by the Vts1p SAM domain
ResolutionN/A
Binding residue
(original residue number in PDB)		Y468 A495 L496 G497 A498
Binding residue
(residue number reindexed from 1)		Y26 A53 L54 G55 A56
Binding affinityPDBbind-CN: Kd=30nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0043488 regulation of mRNA stability

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2b6g, PDBe:2b6g, PDBj:2b6g
PDBsum2b6g
PubMed16429155
UniProtQ08831|VTS1_YEAST RNA-binding protein VTS1 (Gene Name=VTS1)

[Back to BioLiP]