Structure of PDB 2b3g Chain A Binding Site BS01

Receptor Information
>2b3g Chain A (length=117) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITSPPRYRLLMSDGLNTL
SSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLK
SAEAVGVKIGNPVPYNE
Ligand information
>2b3g Chain B (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SPLPSQAMDDLMLSPDDIEQWFTE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2b3g Single-stranded DNA mimicry in the p53 transactivation domain interaction with replication protein A.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		N29 R31 R43 L45 D89 R91 E120
Binding residue
(residue number reindexed from 1)		N29 R31 R40 L42 D86 R88 E117
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006260 DNA replication
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2b3g, PDBe:2b3g, PDBj:2b3g
PDBsum2b3g
PubMed16234232
UniProtP27694|RFA1_HUMAN Replication protein A 70 kDa DNA-binding subunit (Gene Name=RPA1)

[Back to BioLiP]