Structure of PDB 2b26 Chain A Binding Site BS01

Receptor Information

>2b26 Chain A (length=157) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGASEKTQIDIQLKPGWKAGT
KITRKTLQFVIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDG
RTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLND
AQKRAID

Ligand information

>2b26 Chain D (length=7) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PTVEEVD

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2b26 Crystal structure of yeast Sis1 peptide-binding fragment and Hsp70 Ssa1 C-terminal complex.
Resolution	3.2 Å
Binding residue (original residue number in PDB)	S200 F201 K202 G204 K214
Binding residue (residue number reindexed from 1)	S21 F22 K23 G25 K35

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0051082	unfolded protein binding

	Biological Process
GO:0006457	protein folding

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2b26, PDBe:2b26, PDBj:2b26
PDBsum	2b26
PubMed	16737444
UniProt	P25294\|SIS1_YEAST Protein SIS1 (Gene Name=SIS1)

[Back to BioLiP]