Structure of PDB 2b0d Chain A Binding Site BS01

Receptor Information
>2b0d Chain A (length=236) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLRSDLINALYDENQKYDVCGIISAEGKIYPLGSDTKVLSTIFELFSRPI
INKIAEKHGYIVEEPKQQNHYPDFTLYKPSEPNKKIAIDIKTTYTNKEKI
KFTLGGYTSFIRNNTKNIVYPFDQYIAHWIIGYVYTRVLKTYNINELNEI
PKPYKGVKVFLQDKWVIAGDLAGSGNTTNIGSIHAHYKDFVEGKGIFDSE
DEFLDYWRNYERTSQLRNDKYNNISEYRNWIYRGRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2b0d Non-cognate Enzyme-DNA Complex: Structural and Kinetic Analysis of EcoRV Endonuclease Bound to the EcoRI Recognition Site GAATTC
Resolution2.0 Å
Binding residue
(original residue number in PDB)		T37 N70 K92 T93 T94 Y95 T106 T111 S112 K119 S183 T186 N188
Binding residue
(residue number reindexed from 1)		T36 N69 K91 T92 T93 Y94 T103 T108 S109 K116 S174 T177 N179
Binding affinityPDBbind-CN: Kd=900nM
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0009036 type II site-specific deoxyribonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0009307 DNA restriction-modification system

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2b0d, PDBe:2b0d, PDBj:2b0d
PDBsum2b0d
PubMed16236314
UniProtP04390|T2E5_ECOLX Type II restriction enzyme EcoRV (Gene Name=ecoRVR)

[Back to BioLiP]