Structure of PDB 2ayb Chain A Binding Site BS01

Receptor Information
>2ayb Chain A (length=87) Species: 37122 (Human papillomavirus type 6a) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSATPIVQFQGESNCLKCFRYRLNDKHRHLFDLISSTWHWASPKAPHKHA
IVTVTYHSEEQRQQFLNVVKIPPTIRHKLGFMSMHLL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ayb The recognition of local DNA conformation by the human papillomavirus type 6 E2 protein.
Resolution3.2 Å
Binding residue
(original residue number in PDB)
S293 K297 R300 Y301 T316 H318
Binding residue
(residue number reindexed from 1)
S13 K17 R20 Y21 T37 H39
Binding affinityPDBbind-CN: Kd=2nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006275 regulation of DNA replication
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0042025 host cell nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2ayb, PDBe:2ayb, PDBj:2ayb
PDBsum2ayb
PubMed16914454
UniProtQ84294|VE2_HPV6A Regulatory protein E2 (Gene Name=E2)

[Back to BioLiP]