Structure of PDB 2axi Chain A Binding Site BS01

Receptor Information
>2axi Chain A (length=92) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQ
HIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2axi Structure-Activity Studies in a Family of beta-Hairpin Protein Epitope Mimetic Inhibitors of the p53-HDM2 Protein-Protein Interaction.
Resolution1.4 Å
Binding residue
(original residue number in PDB)		K51 L54 F55 G58 I61 Y67 Q72 F86 F91 V93 H96
Binding residue
(residue number reindexed from 1)		K29 L32 F33 G36 I39 Y45 Q50 F64 F69 V71 H74
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Biological Process
GO:0043066 negative regulation of apoptotic process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2axi, PDBe:2axi, PDBj:2axi
PDBsum2axi
PubMed16511824
UniProtQ00987|MDM2_HUMAN E3 ubiquitin-protein ligase Mdm2 (Gene Name=MDM2)

[Back to BioLiP]