Structure of PDB 2aww Chain A Binding Site BS01

Receptor Information
>2aww Chain A (length=91) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTSIVEGGAAHKDGKL
QIGDKLLAVNSVGLEEVTHEEAVTALKNTSDFVYLKVAKPT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2aww Crystal structure of the second PDZ domain of SAP97 in complex with a GluR-A C-terminal peptide
Resolution2.21 Å
Binding residue
(original residue number in PDB)
L329 F331 S332 I333 H384 V388 L391
Binding residue
(residue number reindexed from 1)
L14 F16 S17 I18 H69 V73 L76
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2aww, PDBe:2aww, PDBj:2aww
PDBsum2aww
PubMed17069616
UniProtQ62696|DLG1_RAT Disks large homolog 1 (Gene Name=Dlg1)

[Back to BioLiP]