Structure of PDB 2atw Chain A Binding Site BS01

Receptor Information
>2atw Chain A (length=223) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FSTREGEIVAGVIQRDSRANARGLVVVRIGTETKASEGVIPAAEQVPGES
YEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEIADGSVE
IVAVAREAGHRSKIAVRSNVAGLNAKGACIGPMGQRVRNVMSELSGEKID
IIDYDDDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLSLAIGKE
GQNARLAARLTGWRIDIRGDAPP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2atw Structure of a Mycobacterium tuberculosis NusA-RNA complex.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		R217 N230 K232 G233 A234 I236 G237 P238 M239 R242 R244 K254 I255 D256 I257 S273 P274 F297 L299 S300 L301 I303 K305 G307 R311 A314 I321 D322 I323
Binding residue
(residue number reindexed from 1)		R111 N124 K126 G127 A128 I130 G131 P132 M133 R136 R138 K148 I149 D150 I151 S167 P168 F191 L193 S194 L195 I197 K199 G201 R205 A208 I215 D216 I217
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Biological Process
GO:0006353 DNA-templated transcription termination
GO:0031564 transcription antitermination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2atw, PDBe:2atw, PDBj:2atw
PDBsum2atw
PubMed16193062
UniProtP9WIV3|NUSA_MYCTU Transcription termination/antitermination protein NusA (Gene Name=nusA)

[Back to BioLiP]