Structure of PDB 2atp Chain A Binding Site BS01

Receptor Information
>2atp Chain A (length=118) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFV
VYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCS
VISNSVMYFSSVVPVLQK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2atp Structural and Mutational Analyses of a CD8alphabeta Heterodimer and Comparison with the CD8alphaalpha Homodimer.
Resolution2.4 Å
Binding residue
(original residue number in PDB)
S45 K46
Binding residue
(residue number reindexed from 1)
S42 K43
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2atp, PDBe:2atp, PDBj:2atp
PDBsum2atp
PubMed16356863
UniProtP01731|CD8A_MOUSE T-cell surface glycoprotein CD8 alpha chain (Gene Name=Cd8a)

[Back to BioLiP]