Structure of PDB 2asb Chain A Binding Site BS01

Receptor Information
>2asb Chain A (length=226) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STREGEIVAGVIQRDSRANARGLVVVRIGTETKASEGVIPAAEQVPGESY
EHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEIADGSVEI
VAVAREAGHRSKIAVRSNVAGLNAKGACIGPMGQRVRNVMSELSGEKIDI
IDYDDDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLSLAIGKEG
QNARLAARLTGWRIDIRGDAPPPPPG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2asb Structure of a Mycobacterium tuberculosis NusA-RNA complex.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		R217 G233 I236 M239 R244 K254 I255 D256 I257 S273 P274 F297 L299 S300 L301 I303 K305 E306 G307 A310 R311 A314 I321 D322 I323
Binding residue
(residue number reindexed from 1)		R110 G126 I129 M132 R137 K147 I148 D149 I150 S166 P167 F190 L192 S193 L194 I196 K198 E199 G200 A203 R204 A207 I214 D215 I216
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Biological Process
GO:0006353 DNA-templated transcription termination
GO:0031564 transcription antitermination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2asb, PDBe:2asb, PDBj:2asb
PDBsum2asb
PubMed16193062
UniProtP9WIV3|NUSA_MYCTU Transcription termination/antitermination protein NusA (Gene Name=nusA)

[Back to BioLiP]