Structure of PDB 2arq Chain A Binding Site BS01

Receptor Information
>2arq Chain A (length=360) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTED
QMASVLQFNEDKIHSSFRSLSSAINASTGNYLLESVNKLFGEKSASFREE
YIRLCQKYYSSEPQAVDFLECAEEARKKINSWVKTQTKGKIPNLLPEGSV
DGDTRMVLVNAVYFKGKWKTPFEKKLLFPFRVNSAQRTPVQMMYLREKLN
IGYIEDLKAQILELPYAGDVSMFLLLPDADVSTGLELLESEITYDKLNKW
TSKDKMAEDEVEVYIPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMS
ERNDLFLSEVFHQAMVDVNEEGTGRTGHGGPQFVADHPFLFLIMHKITNC
ILFFGRFSSP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2arq Plasminogen activator inhibitor-2 is highly tolerant to P8 residue substitution--implications for serpin mechanistic model and prediction of nsSNP activities
Resolution1.85 Å
Binding residue
(original residue number in PDB)		T38 K180 L184 D193 T194 R195 M196 V197 L198 V199 N200 A201 V202 Y203 F204 K205 G206 W208 Y258 K335 A338 F340 N347 D348 L349 F350 L351 S352 E353 V354 F355 H356 Q357 A358 M359 V360 D361 V362 N363 F408
Binding residue
(residue number reindexed from 1)		T36 K140 L144 D153 T154 R155 M156 V157 L158 V159 N160 A161 V162 Y163 F164 K165 G166 W168 Y216 K291 A294 F296 N303 D304 L305 F306 L307 S308 E309 V310 F311 H312 Q313 A314 M315 V316 D317 V318 N319 F353
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004867 serine-type endopeptidase inhibitor activity
Biological Process
GO:0010466 negative regulation of peptidase activity
GO:0042730 fibrinolysis
GO:0043066 negative regulation of apoptotic process
Cellular Component
GO:0001533 cornified envelope
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005737 cytoplasm
GO:0005886 plasma membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2arq, PDBe:2arq, PDBj:2arq
PDBsum2arq
PubMed16214170
UniProtP05120|PAI2_HUMAN Plasminogen activator inhibitor 2 (Gene Name=SERPINB2)

[Back to BioLiP]