Structure of PDB 2aor Chain A Binding Site BS01

Receptor Information

>2aor Chain A (length=220) Species: 727 (Haemophilus influenzae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MIPQTLEQLLSQAQSIAGLTFGELADELHIPVPIDLKRDKGWVGMLLERA
LGATAGSKAEQDFSHLGVELKTLPINAEGYPLETTFVSLAPLVQNSGVKW
ENSHVRHKLSCVLWMPIEGSRHIPLRERHIGAPIFWKPTAEQERQLKQDW
EELMDLIVLGKLDQITARIGEVMQLRPKGANSRAVTKGIGKNGEIIDTLP
LGFYLRKEFTAQILNAFLET

Ligand information

>2aor Chain C (length=22) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

caggatccaagcttggatcctg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2aor MutH complexed with hemi- and unmethylated DNAs: coupling base recognition and DNA cleavage.
Resolution	2.0 Å
Binding residue (original residue number in PDB)	R46 K48 M53 T174 A175 R184 P185 G187 A188 N189 S190
Binding residue (residue number reindexed from 1)	R38 K40 M45 T166 A167 R176 P177 G179 A180 N181 S182
Binding affinity	PDBbind-CN: Kd=0.9uM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004519	endonuclease activity

	Biological Process
GO:0006281	DNA repair
GO:0006298	mismatch repair
GO:0006304	DNA modification

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2aor, PDBe:2aor, PDBj:2aor
PDBsum	2aor
PubMed	16209953
UniProt	P44688\|MUTH_HAEIN DNA mismatch repair protein MutH (Gene Name=mutH)

[Back to BioLiP]