Structure of PDB 2aoq Chain A Binding Site BS01

Receptor Information
>2aoq Chain A (length=220) Species: 727 (Haemophilus influenzae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MIPQTLEQLLSQAQSIAGLTFGELADELHIPVPIDLKRDKGWVGMLLERA
LGATAGSKAEQDFSHLGVELKTLPINAEGYPLETTFVSLAPLVQNSGVKW
ENSHVRHKLSCVLWMPIEGSRHIPLRERHIGAPIFWKPTAEQERQLKQDW
EELMDLIVLGKLDQITARIGEVMQLRPKGANSRAVTKGIGKNGEIIDTLP
LGFYLRKEFTAQILNAFLET
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2aoq MutH complexed with hemi- and unmethylated DNAs: coupling base recognition and DNA cleavage.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		R46 K48 T174 A175 R176 R184 G187 A188 N189 S190 R214 K215
Binding residue
(residue number reindexed from 1)		R38 K40 T166 A167 R168 R176 G179 A180 N181 S182 R206 K207
Binding affinityPDBbind-CN: Kd=3.5uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
Biological Process
GO:0006281 DNA repair
GO:0006298 mismatch repair
GO:0006304 DNA modification
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2aoq, PDBe:2aoq, PDBj:2aoq
PDBsum2aoq
PubMed16209953
UniProtP44688|MUTH_HAEIN DNA mismatch repair protein MutH (Gene Name=mutH)

[Back to BioLiP]