Structure of PDB 2ann Chain A Binding Site BS01

Receptor Information
>2ann Chain A (length=148) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSQYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTT
ERVCLIQGTIEALNAVHGFIAEKIREMPPDRANQVKIIVPNSTAGLIIGK
GGATVKAIMEQSGAWVQLSQNRVVTVSGEPEQNRKAVELIIQKIQEDP
Ligand information
>2ann Chain B (length=23) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgcggaucagucacccaagcgcg
<<<...............>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ann Protein-RNA and protein-protein recognition by dual KH1/2 domains of the neuronal splicing factor Nova-1.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		G18 S19 I21 G22 K23 G24 G25 L41 K43 S44 R54
Binding residue
(residue number reindexed from 1)		G16 S17 I19 G20 K21 G22 G23 L39 K41 S42 R52
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:2ann, PDBe:2ann, PDBj:2ann
PDBsum2ann
PubMed21742260
UniProtP51513|NOVA1_HUMAN RNA-binding protein Nova-1 (Gene Name=NOVA1)

[Back to BioLiP]