Structure of PDB 2an6 Chain A Binding Site BS01

Receptor Information
>2an6 Chain A (length=191) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NSVLFPCKYASSGCEITLPHTEKAEHEELCEFRPYSCPCPGASCKWQGSL
DAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFML
VLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPR
SIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2an6 Elucidation of the substrate binding site of Siah ubiquitin ligase
Resolution3.0 Å
Binding residue
(original residue number in PDB)		D162 V164 F165 L166 T168 L172 V176 D177 W178 M180 N276
Binding residue
(residue number reindexed from 1)		D71 V73 F74 L75 T77 L81 V85 D86 W87 M89 N185
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
Biological Process
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0007275 multicellular organism development
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2an6, PDBe:2an6, PDBj:2an6
PDBsum2an6
PubMed16615911
UniProtP61092|SIA1A_MOUSE E3 ubiquitin-protein ligase SIAH1A (Gene Name=Siah1a)

[Back to BioLiP]