Structure of PDB 2adu Chain A Binding Site BS01

Receptor Information

>2adu Chain A (length=355) Species: 9606 (Homo sapiens)

KVQTDPPSVPICDLYPNGVFPKGQECEYPEEKKALDQASEEIWNDFREAA
EAHRQVRKYVMSWIKPGMTMIEICEKLEDCSRKLIKENGLNAGLAFPTGC
SLNNCAAHYTPNAGDTTVLQYDDICKIDFGTHISGRIIDCAFTVTFNPKY
DTLLKAVKDATNTGIKCAGIDVRLCDVGEAIQEVMESYEVEIDGKTYQVK
PIRNLNGHSIGQYRIHAGKTVPIIKGGEATRMEEGEVYAIETFGSTGKGV
VHDDMECSHYMKNFDVGHVPIRLPRTKHLLNVINENFGTLAFCRRWLDRL
GESKYLMALKNLCDLGIVDPYPPLCDIKGSYTAQFEHTILLRPTCKEVVS
RGDDY

Ligand information

• Ligand ID: CO
• InChI: InChI=1S/Co/q+2
• InChIKey: XLJKHNWPARRRJB-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Co+2]
  CACTVS 3.341: [Co++]
• Formula: Co
• Name: COBALT (II) ION
• DrugBank: DB14205
• PDB chain: 2adu Chain A Residue 501

Receptor-Ligand Complex Structure

Structure summary

Jmol._Canvas2D (Jmol) "jmolApplet0"[x]

loadScript jsmol/j2s/core/corebio.z.js

JSmol exec jmolApplet1 start applet null

Jmol JavaScript applet jmolApplet1__7860177221038578__ initializing

Jmol getValue debug null

Jmol getValue logLevel null

Jmol getValue allowjavascript null

AppletRegistry.checkIn(jmolApplet1__7860177221038578__)

vwrOptions:

{ "name":"jmolApplet1","applet":true,"documentBase":"https://zhanglab.comp.nus.edu.sg/BioLiP/pdb.cgi?bs=BS01&chain=A&pdb=2adu","platform":"J.awtjs2d.Platform","fullName":"jmolApplet1__7860177221038578__","codePath":"https://zhanglab.comp.nus.edu.sg/BioLiP/jsmol/j2s/","display":"jmolApplet1_canvas2d","signedApplet":"true","appletReadyCallback":"Jmol._readyCallback","statusListener":"[J.appletjs.Jmol object]","syncId":"7860177221038578","bgcolor":"#FFFFFF" }

setting document base to "https://zhanglab.comp.nus.edu.sg/BioLiP/pdb.cgi?bs=BS01&chain=A&pdb=2adu"

(C) 2015 Jmol Development

Jmol Version: 14.32.79 2022-10-26 15:52

java.vendor: Java2Script (HTML5)

java.version: 2022-06-24 05:54:49 (JSmol/j2s)

os.name: Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)

Access: ALL

memory: 0.0/0.0

processors available: 1

useCommandThread: false

appletId:jmolApplet1 (signed)

Jmol getValue emulate null

defaults = "Jmol"

Jmol getValue boxbgcolor null

Jmol getValue bgcolor #FFFFFF

backgroundColor = "#FFFFFF"

Jmol getValue ANIMFRAMECallback null

Jmol getValue APPLETREADYCallback Jmol._readyCallback

APPLETREADYCallback = "Jmol._readyCallback"

StatusManager callback set for APPLETREADYCallback f=Jmol._readyCallback cb=APPLETREADY

Jmol getValue ATOMMOVEDCallback null

Jmol getValue AUDIOCallback null

Jmol getValue CLICKCallback null

Jmol getValue DRAGDROPCallback null

Jmol getValue ECHOCallback null

Jmol getValue ERRORCallback null

Jmol getValue EVALCallback null

Jmol getValue HOVERCallback null

Jmol getValue IMAGECallback null

Jmol getValue LOADSTRUCTCallback null

Jmol getValue MEASURECallback null

Jmol getValue MESSAGECallback null

Jmol getValue MINIMIZATIONCallback null

Jmol getValue MODELKITCallback null

Jmol getValue PICKCallback null

Jmol getValue RESIZECallback null

Jmol getValue SCRIPTCallback null

Jmol getValue SELECTCallback null

Jmol getValue SERVICECallback null

Jmol getValue STRUCTUREMODIFIEDCallback null

Jmol getValue SYNCCallback null

Jmol getValue doTranslate null

language=en_US

Jmol getValue popupMenu null

Jmol getValue script null

Jmol getValue loadInline null

Jmol getValue load null

Jmol applet jmolApplet1__7860177221038578__ ready

Jmol._Canvas2D (Jmol) "jmolApplet1"[x]

loadScript jsmol/j2s/core/package.js

loadScript jsmol/j2s/core/corejmol.z.js

loadScript jsmol/j2s/core/corescript.z.js

JSmol exec jmolApplet0 start applet null

Jmol JavaScript applet jmolApplet0__7860177221038578__ initializing

Jmol getValue debug null

Jmol getValue logLevel null

Jmol getValue allowjavascript null

AppletRegistry.checkIn(jmolApplet0__7860177221038578__)

vwrOptions:

{ "name":"jmolApplet0","applet":true,"documentBase":"https://zhanglab.comp.nus.edu.sg/BioLiP/pdb.cgi?bs=BS01&chain=A&pdb=2adu","platform":"J.awtjs2d.Platform","fullName":"jmolApplet0__7860177221038578__","codePath":"https://zhanglab.comp.nus.edu.sg/BioLiP/jsmol/j2s/","display":"jmolApplet0_canvas2d","signedApplet":"true","appletReadyCallback":"Jmol._readyCallback","statusListener":"[J.appletjs.Jmol object]","syncId":"7860177221038578","bgcolor":"#FFFFFF" }

setting document base to "https://zhanglab.comp.nus.edu.sg/BioLiP/pdb.cgi?bs=BS01&chain=A&pdb=2adu"

(C) 2015 Jmol Development

Jmol Version: 14.32.79 2022-10-26 15:52

java.vendor: Java2Script (HTML5)

java.version: 2022-06-24 05:54:49 (JSmol/j2s)

os.name: Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)

Access: ALL

memory: 0.0/0.0

processors available: 1

useCommandThread: false

appletId:jmolApplet0 (signed)

Jmol getValue emulate null

defaults = "Jmol"

Jmol getValue boxbgcolor null

Jmol getValue bgcolor #FFFFFF

backgroundColor = "#FFFFFF"

Jmol getValue ANIMFRAMECallback null

Jmol getValue APPLETREADYCallback Jmol._readyCallback

APPLETREADYCallback = "Jmol._readyCallback"

StatusManager callback set for APPLETREADYCallback f=Jmol._readyCallback cb=APPLETREADY

Jmol getValue ATOMMOVEDCallback null

Jmol getValue AUDIOCallback null

Jmol getValue CLICKCallback null

Jmol getValue DRAGDROPCallback null

Jmol getValue ECHOCallback null

Jmol getValue ERRORCallback null

Jmol getValue EVALCallback null

Jmol getValue HOVERCallback null

Jmol getValue IMAGECallback null

Jmol getValue LOADSTRUCTCallback null

Jmol getValue MEASURECallback null

Jmol getValue MESSAGECallback null

Jmol getValue MINIMIZATIONCallback null

Jmol getValue MODELKITCallback null

Jmol getValue PICKCallback null

Jmol getValue RESIZECallback null

Jmol getValue SCRIPTCallback null

Jmol getValue SELECTCallback null

Jmol getValue SERVICECallback null

Jmol getValue STRUCTUREMODIFIEDCallback null

Jmol getValue SYNCCallback null

Jmol getValue doTranslate null

language=en_US

Jmol getValue popupMenu null

Jmol getValue script null

Jmol getValue loadInline null

Jmol getValue load null

Jmol applet jmolApplet0__7860177221038578__ ready

script 1 started

script 1 started

• PDB: 2adu 4-Aryl-1,2,3-triazole: A Novel Template for a Reversible Methionine Aminopeptidase 2 Inhibitor, Optimized To Inhibit Angiogenesis in Vivo
• Resolution: 1.9 Å
• Binding residue (original residue number in PDB): D251 D262 E459
• Binding residue (residue number reindexed from 1): D128 D139 E336
• Annotation score: 3

Enzymatic activity

• Catalytic site (original residue number in PDB): D251 D262 H331 H339 E364 E459
• Catalytic site (residue number reindexed from 1): D128 D139 H208 H216 E241 E336
• Enzyme Commision number: 3.4.11.18: methionyl aminopeptidase.

Gene Ontology

Molecular Function

• GO:0070006 metalloaminopeptidase activity

Biological Process

• GO:0006508 proteolysis

External links

• PDB: RCSB:2adu, PDBe:2adu, PDBj:2adu
• PDBsum: 2adu
• PubMed: 16134930
• UniProt: P50579|MAP2_HUMAN Methionine aminopeptidase 2 (Gene Name=METAP2)

Application loaded.