Structure of PDB 2adc Chain A Binding Site BS01

Receptor Information

>2adc Chain A (length=208) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GRIAIPGLAGAGNSVLLVSNLNPERVTPQSLFILFGVYGDVQRVKILFNK
KENALVQMADGNQAQLAMSHLNGHKLHGKPIRITLSKHQNVQLPREGQED
QGLTKDYGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEEDLKVL
FSSNGGVVKGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLR
VSFSKSTI

Ligand information

>2adc Chain B (length=6) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cucucu

......

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2adc Structure of PTB bound to RNA: specific binding and implications for splicing regulation
Resolution	N/A
Binding residue (original residue number in PDB)	N448 H457 S459 K485 F487 Q488 K489 K492 M493 N519 R523 V524 S525 S527 K528
Binding residue (residue number reindexed from 1)	N125 H134 S136 K162 F164 Q165 K166 K169 M170 N196 R200 V201 S202 S204 K205

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding

	Biological Process
GO:0006397	mRNA processing

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2adc, PDBe:2adc, PDBj:2adc
PDBsum	2adc
PubMed	16179478
UniProt	P26599\|PTBP1_HUMAN Polypyrimidine tract-binding protein 1 (Gene Name=PTBP1)

[Back to BioLiP]