Structure of PDB 2adb Chain A Binding Site BS01

Receptor Information
>2adb Chain A (length=127) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DAGMAMAGQSPVLRIIVENLFYPVTLDVLHQIFSKFGTVLKIITFTKNNQ
FQALLQYADPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDK
SRDYTRPDLPSGDSQPSLDQTMAAAFG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2adb Structure of PTB bound to RNA: specific binding and implications for splicing regulation
ResolutionN/A
Binding residue
(original residue number in PDB)
R185 I214 F216 K218 Q221 Q223 L225 S258 K259 L260 L263 N264 K266 Y267 N269 D270 K271
Binding residue
(residue number reindexed from 1)
R14 I43 F45 K47 Q50 Q52 L54 S87 K88 L89 L92 N93 K95 Y96 N98 D99 K100
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:2adb, PDBe:2adb, PDBj:2adb
PDBsum2adb
PubMed16179478
UniProtP26599|PTBP1_HUMAN Polypyrimidine tract-binding protein 1 (Gene Name=PTBP1)

[Back to BioLiP]