Structure of PDB 2ad9 Chain A Binding Site BS01

Receptor Information
>2ad9 Chain A (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GDSRSAGVPSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAF
IEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELKTDSSPNQAR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ad9 Structure of PTB bound to RNA: specific binding and implications for splicing regulation
ResolutionN/A
Binding residue
(original residue number in PDB)		R52 H62 R64 K65 L89 L91 K94 N95 Q96 F98 Q129 S131 N132 H133 L136 K137
Binding residue
(residue number reindexed from 1)		R4 H14 R16 K17 L41 L43 K46 N47 Q48 F50 Q81 S83 N84 H85 L88 K89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:2ad9, PDBe:2ad9, PDBj:2ad9
PDBsum2ad9
PubMed16179478
UniProtP26599|PTBP1_HUMAN Polypyrimidine tract-binding protein 1 (Gene Name=PTBP1)

[Back to BioLiP]