Structure of PDB 2ab4 Chain A Binding Site BS01

Receptor Information
>2ab4 Chain A (length=300) Species: 2336 (Thermotoga maritima) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKHGILVAYKPKGPTSHDVVDEVRKKLKTRKVGHGGTLDPFACGVLIIGV
NQGTRILEFYKDLKKVFWVKMRLGLITETFDITGEVVEERECNVTEEEIR
EAIFSFVGEYDQVPPAYSAKKYKGERLYKLAREGKIINLPPKRVKIFKIW
DVNIEGRDVSFRVEVSPGTYIRSLCMDIGYKLGCGATAVELVRESVGPHT
IEESLNVFEAAPEEIENRIIPLEKCLEWLPRVVVHQESTKMILNGSQIHL
EMLKEWDGFKKGEVVRVFNEEGRLLALAEAERNSSFRQERVLTLRKVFQT
Ligand information
>2ab4 Chain B (length=20) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccacgguucgaauccguggc
<<<<<<.......>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ab4 Dissecting the roles of a strictly conserved tyrosine in substrate recognition and catalysis by pseudouridine 55 synthase.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		T15 H17 K31 V32 G33 H34 G36 T37 L38 D39 P40 T54 K61 F67 T79 D81 Y117 S118 A119 K120 K121 G124 R126 Y128 R132 Y170 I171 R172 L191
Binding residue
(residue number reindexed from 1)		T15 H17 K31 V32 G33 H34 G36 T37 L38 D39 P40 T54 K61 F67 T79 D81 Y117 S118 A119 K120 K121 G124 R126 Y128 R132 Y170 I171 R172 L191
Enzymatic activity
Enzyme Commision number 5.4.99.25: tRNA pseudouridine(55) synthase.
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0009982 pseudouridine synthase activity
GO:0016853 isomerase activity
GO:0140098 catalytic activity, acting on RNA
GO:0160148 tRNA pseudouridine(55) synthase activity
Biological Process
GO:0001522 pseudouridine synthesis
GO:0006396 RNA processing
GO:0006400 tRNA modification
GO:0008033 tRNA processing
GO:0009451 RNA modification
GO:0031119 tRNA pseudouridine synthesis
GO:1990481 mRNA pseudouridine synthesis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2ab4, PDBe:2ab4, PDBj:2ab4
PDBsum2ab4
PubMed16300397
UniProtQ9WZW0|TRUB_THEMA tRNA pseudouridine synthase B (Gene Name=truB)

[Back to BioLiP]